Ezlato.cz
Ezlato
Site Traffic
Daily Visitors by Country / Region
Where are the visitors who visited the website Ezlato.cz?
Daily Visitors (Last 90 days)
The chart below shows how many visitors visited the website Ezlato.cz every day for the past 90 days.
Daily Visitors by Subdomain
What subdomains visitors often go on Ezlato.cz?
Daily Visitors by Keyword
What search keywords send traffic to the website Ezlato.cz?
Linking In & Out
What websites did visitors come from, and then what websites did they go to.
Site Domain
Domain profile
Here is the domain information about Ezlato.cz .
Domain Name: | Ezlato.cz |
---|---|
Domain Age: | 15 years |
Time Left: | 1 year |
Domain Owner: | - |
Owner's Email: | helpdesk@webglobe.cz |
Name server: | |
Domain Status: | - |
Updated Date: | - |
Creation Date: | 2009-02-26 |
Expiration Date: | 2026-02-26 |
Sponsor: | REG-WEBGLOBE |
Sponsor URL: | - |
Domain Whois
Domain Whois is a query and response protocol that is widely used for querying databases that store the registered users or assignees of a domain name. The following information is the Whois of the domain Ezlato.cz. Learn more Whois
DNS Record
The Domain Name System (DNS) is a hierarchical and decentralized naming system for computers, services, or other resources connected to the Internet or a private network. It associates various information with domain names assigned to each of the participating entities. The table below shows the DNS record for the domain name Ezlato.cz.
Name Server
The table below shows the Name Server for the domain name Ezlato.cz.
Site Server
Server Location
Where are Ezlato.cz website's servers located?
# | IP Address | Country / Region | City |
---|---|---|---|
1 | 185.64.219.37 | | - |
Site Referrals
Similar Sites
What websites are similar to the website Ezlato.cz on the web?
- Livres BQ
Livres-BQ.com- Rank: n/a Visitors: n/a
- Son catalogue de près de 250 titres propose le meilleur de la littérature québécoise et canadienne-anglaise en traduction.
- Paddock
Paddock.co.th- Rank: #15,705,257 Visitors: 200
- Bargain Guitars
Bargain-Guitars.com- Rank: n/a Visitors: n/a
- Angelsafety
Angelsafety.com- Rank: n/a Visitors: n/a
- Fortlangleyvillagefarmersmarket
Fortlangleyvillagefarmersmarket.org- Rank: n/a Visitors: n/a
- Theoldcandlefactory
Theoldcandlefactory.com- Rank: n/a Visitors: n/a
- Treasurelanding
Treasurelanding.com- Rank: n/a Visitors: n/a
- Treasure Landing is a unique gift shop in Fort Langley, British Columbia. You'll find products from Thymes, Lampe Berger, and Pr ...
- Townshipoflangleyreuses
Townshipoflangleyreuses.com- Rank: n/a Visitors: n/a
Other sites hosted on the same server
What websites are stored on the same server as the website Ezlato.cz?
Other sites owned
What websites are owned by the same person who owns Ezlato.cz website? The websites below are owned by the same owner or not.
Backward Links
What websites are linking to the website Ezlato.cz?