7Dayhaulaway.com
24/7 service
Site Traffic
Daily Visitors by Country / Region
Where are the visitors who visited the website 7Dayhaulaway.com?
Daily Visitors (Last 90 days)
The chart below shows how many visitors visited the website 7Dayhaulaway.com every day for the past 90 days.
Daily Visitors by Subdomain
What subdomains visitors often go on 7Dayhaulaway.com?
Daily Visitors by Keyword
What search keywords send traffic to the website 7Dayhaulaway.com?
Linking In & Out
What websites did visitors come from, and then what websites did they go to.
Site Domain
Domain profile
Here is the domain information about 7Dayhaulaway.com .
| Domain Name: | 7Dayhaulaway.com |
|---|---|
| Domain Age: | 5 years |
| Time Left: | -2 years (2022-01-10) |
| Domain Owner: | - |
| Owner's Email: | 7dayhaulaway.com@domainsbyproxy.com |
| Name server: | |
| Domain Status: | |
| Updated Date: | 2021-01-11 |
| Creation Date: | 2020-01-10 |
| Expiration Date: | 2022-01-10 |
| Sponsor: | GoDaddy.com, LLC |
| Sponsor URL: | http://www.godaddy.com |
Domain Whois
Domain Whois is a query and response protocol that is widely used for querying databases that store the registered users or assignees of a domain name. The following information is the Whois of the domain 7Dayhaulaway.com. Learn more Whois
DNS Record
The Domain Name System (DNS) is a hierarchical and decentralized naming system for computers, services, or other resources connected to the Internet or a private network. It associates various information with domain names assigned to each of the participating entities. The table below shows the DNS record for the domain name 7Dayhaulaway.com.
Name Server
The table below shows the Name Server for the domain name 7Dayhaulaway.com.
Site Server
Server Location
Where are 7Dayhaulaway.com website's servers located?
| # | IP Address | Country / Region | City |
|---|---|---|---|
| 1 | 199.250.212.6 | | - |
Site Referrals
Similar Sites
What websites are similar to the website 7Dayhaulaway.com on the web?
- Drainrescue melbourne
- Rank: #5,853,904 Visitors: 4,200
- Drain Rescue- Emergency Plumber in Mount Waverley, Melbourne offers professional & reliable blocked drain service. Call 0433 554 ...
- Ntwinvestigations
- Rank: #8,878,916 Visitors: 2,900
- We're the security experts. We offer VIP protection, security guard services, bodyguard services and more. (800) 294-6042.
- Vzenvironmental
- Rank: #9,018,211 Visitors: 2,900
- 24/7 Service - Rental for Oil & Gas Rigups. Permian, Barnett, Eagleford, Haynesville, Midcon since 2010. Safety Certified. Relia ...
- Sastowing
- Rank: #2,183,555 Visitors: 7,900
- 24/7 Service - Light, Medium, & Heavy-Duty Towing & Recovery Service, Georgetown, Salado, Florence, Round Rock, Hutto, and Jarre ...
- Huntschimneysweepandrepairservices
- Rank: #5,696,722 Visitors: 4,200
- Citywideliquidwaste
- Rank: #7,199,217 Visitors: 3,500
- We do septic tanks cleaning, septic tank pump outs & maintenance in Melbourne,citywideliquidwaste
- Sinclairbaysubsea
- Rank: #1,265,233 Visitors: 11,000
- Our core business is Subsea Equipment, however we offer secure long-term storage for all Oilfield, Decommissioning and Renewable ...
- Bespokewonders
- Rank: #1,611,418 Visitors: 9,700
- Premium Rubber stamps
Other sites hosted on the same server
What websites are stored on the same server as the website 7Dayhaulaway.com?
Other sites owned
What websites are owned by the same person who owns 7Dayhaulaway.com website? The websites below are owned by the same owner or not.
Backward Links
What websites are linking to the website 7Dayhaulaway.com?